PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr011263.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 281aa    MW: 31874.2 Da    PI: 6.2302
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr011263.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ +v ++G ++W++ ++  g+ R++k+c++rw +yl
      Pbr011263.1 14 KGAWSPEEDSMLKAYVDKHGHKNWRALPKLSGLARCGKSCRLRWMNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.71.2e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ ++eE  l++++++++G++ W+tIa +++ gRt++++k++w++y
      Pbr011263.1  67 KGNYSQEENNLIIKLHEEFGNK-WSTIATKLP-GRTDNDIKNHWHTY 111
                      7899******************.*********.************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.184961IPR017930Myb domain
SuperFamilySSF466892.42E-3011108IPR009057Homeodomain-like
SMARTSM007172.4E-121363IPR001005SANT/Myb domain
PfamPF002495.3E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-221568IPR009057Homeodomain-like
CDDcd001675.87E-111661No hitNo description
PROSITE profilePS5129424.3162116IPR017930Myb domain
SMARTSM007173.3E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2569114IPR009057Homeodomain-like
CDDcd001678.86E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MVRAPFYDKN GLKKGAWSPE EDSMLKAYVD KHGHKNWRAL PKLSGLARCG KSCRLRWMNY  60
LQPGVKKGNY SQEENNLIIK LHEEFGNKWS TIATKLPGRT DNDIKNHWHT YFKKLTKQNS  120
TALSQTTEQS SDAPSVTSQN TELEAQSAPK HDNNGHQILE SSPLSPETFS SGHSSLSSNI  180
NHGHDQPIVS YFSAEDGTLA SSETILDKSS GDFWTEPFQP DNMMNDVQSE YYPITYLREE  240
GILSSPFVTF YDTHDGMDWF HQVMPTLQNN YLINDADYLR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-26121145106B-MYB
1gv2_A7e-26121142103MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-251211425126MYB TRANSFORMING PROTEIN
1mse_C7e-26121142103C-Myb DNA-Binding Domain
1msf_C7e-26121142103C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342092.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLM5XF331e-93M5XF33_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.16e-57myb domain protein 15